Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | DinJ-YafQ (relBE)/YafQ-DinJ |
| Location | 603161..603713 | Replicon | chromosome |
| Accession | NZ_CP113913 | ||
| Organism | Bifidobacterium sp. ESL0800 | ||
Toxin (Protein)
| Gene name | yafQ | Uniprot ID | - |
| Locus tag | OZX75_RS02470 | Protein ID | WP_277146668.1 |
| Coordinates | 603423..603713 (+) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | dinJ | Uniprot ID | - |
| Locus tag | OZX75_RS02465 | Protein ID | WP_277146667.1 |
| Coordinates | 603161..603442 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZX75_RS02445 (OZX75_02445) | 599261..599521 | - | 261 | WP_277144664.1 | 30S ribosomal protein S20 | - |
| OZX75_RS02450 (OZX75_02450) | 599784..601676 | + | 1893 | WP_277146664.1 | translation elongation factor 4 | - |
| OZX75_RS02455 (OZX75_02455) | 601682..602365 | + | 684 | WP_277146665.1 | nitroreductase family protein | - |
| OZX75_RS02460 (OZX75_02460) | 602671..602904 | - | 234 | WP_277146666.1 | hypothetical protein | - |
| OZX75_RS02465 (OZX75_02465) | 603161..603442 | + | 282 | WP_277146667.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OZX75_RS02470 (OZX75_02470) | 603423..603713 | + | 291 | WP_277146668.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
| OZX75_RS02475 (OZX75_02475) | 603784..605154 | + | 1371 | WP_277146669.1 | radical SAM family heme chaperone HemW | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11436.28 Da Isoelectric Point: 10.5749
>T266153 WP_277146668.1 NZ_CP113913:603423-603713 [Bifidobacterium sp. ESL0800]
VALQRIERSPTFLRQAKALGRKHYDLDKLERVVRVLVNEDKETLRRRYHDHALKGNLSVFRELHIESDWLLIYRVKHETL
TLLLVETGSHRQLLGK
VALQRIERSPTFLRQAKALGRKHYDLDKLERVVRVLVNEDKETLRRRYHDHALKGNLSVFRELHIESDWLLIYRVKHETL
TLLLVETGSHRQLLGK
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|