Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-YefM |
Location | 1727926..1728431 | Replicon | chromosome |
Accession | NZ_CP113865 | ||
Organism | Caldicellulosiruptor morganii strain DSM 8990 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A9E9EF83 |
Locus tag | OTK00_RS08600 | Protein ID | WP_045169881.1 |
Coordinates | 1727926..1728189 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | A0A9E9EJI2 |
Locus tag | OTK00_RS08605 | Protein ID | WP_045169882.1 |
Coordinates | 1728174..1728431 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OTK00_RS08570 (OTK00_001714) | 1724506..1725204 | + | 699 | WP_045169875.1 | TVP38/TMEM64 family protein | - |
OTK00_RS08575 (OTK00_001715) | 1725237..1726499 | - | 1263 | WP_045169876.1 | serine--tRNA ligase | - |
OTK00_RS08585 (OTK00_001717) | 1726759..1727181 | - | 423 | WP_045169877.1 | hypothetical protein | - |
OTK00_RS08590 (OTK00_001718) | 1727399..1727623 | - | 225 | WP_045169879.1 | type II toxin-antitoxin system HicA family toxin | - |
OTK00_RS08595 (OTK00_001719) | 1727625..1727876 | - | 252 | WP_268760767.1 | type II toxin-antitoxin system HicB family antitoxin | - |
OTK00_RS08600 (OTK00_001720) | 1727926..1728189 | - | 264 | WP_045169881.1 | Txe/YoeB family addiction module toxin | Toxin |
OTK00_RS08605 (OTK00_001721) | 1728174..1728431 | - | 258 | WP_045169882.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OTK00_RS08610 (OTK00_001722) | 1728603..1729364 | - | 762 | WP_045169883.1 | ABC transporter ATP-binding protein | - |
OTK00_RS08615 (OTK00_001723) | 1729361..1730158 | - | 798 | WP_045169884.1 | energy-coupling factor transporter transmembrane component T | - |
OTK00_RS08620 (OTK00_001724) | 1730167..1730490 | - | 324 | WP_082054642.1 | hypothetical protein | - |
OTK00_RS08625 (OTK00_001725) | 1730490..1731164 | - | 675 | Protein_1684 | energy-coupling factor ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10563.46 Da Isoelectric Point: 9.9836
>T266136 WP_045169881.1 NZ_CP113865:c1728189-1727926 [Caldicellulosiruptor morganii]
MGYKLKFSKYALKDAKKLEECGLDKKAKEILRILKENLYQNPPPYEKLKGELSGKFSRRINIQHRIIYEVLEEEKIVKIY
RMWTHYE
MGYKLKFSKYALKDAKKLEECGLDKKAKEILRILKENLYQNPPPYEKLKGELSGKFSRRINIQHRIIYEVLEEEKIVKIY
RMWTHYE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|