Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2689228..2689626 | Replicon | chromosome |
| Accession | NZ_CP113832 | ||
| Organism | Enterococcus faecalis strain M61 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q82Z30 |
| Locus tag | OZF29_RS13005 | Protein ID | WP_002387585.1 |
| Coordinates | 2689483..2689626 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2689228..2689372 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| - (2684507) | 2684507..2684683 | - | 177 | NuclAT_14 | - | - |
| - (2684541) | 2684541..2684695 | - | 155 | NuclAT_7 | - | - |
| OZF29_RS12995 (2684835) | 2684835..2684939 | + | 105 | WP_021164545.1 | putative holin-like toxin | - |
| - (2684872) | 2684872..2685127 | - | 256 | NuclAT_0 | - | - |
| OZF29_RS13000 (2685129) | 2685129..2688887 | - | 3759 | WP_116495142.1 | WxL domain-containing protein | - |
| - (2689228) | 2689228..2689372 | - | 145 | NuclAT_5 | - | Antitoxin |
| - (2689230) | 2689230..2689372 | - | 143 | NuclAT_15 | - | - |
| OZF29_RS13005 (2689483) | 2689483..2689626 | + | 144 | WP_002387585.1 | putative holin-like toxin | Toxin |
| - (2689601) | 2689601..2689815 | - | 215 | NuclAT_2 | - | - |
| - (2689767) | 2689767..2689816 | + | 50 | NuclAT_18 | - | - |
| - (2689558) | 2689558..2689817 | - | 260 | NuclAT_13 | - | - |
| OZF29_RS13010 (2689817) | 2689817..2692861 | - | 3045 | WP_161970605.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5244.37 Da Isoelectric Point: 10.5719
>T266122 WP_002387585.1 NZ_CP113832:2689483-2689626 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILKVVKEDKKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT266122 NZ_CP113832:c2689372-2689228 [Enterococcus faecalis]
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCTTT
TTAGTTACAAAAAATAACCGTACTCAGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGC
TTGTGCTATAATAGCAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCTTT
TTAGTTACAAAAAATAACCGTACTCAGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|