Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2611770..2612189 | Replicon | chromosome |
| Accession | NZ_CP113832 | ||
| Organism | Enterococcus faecalis strain M61 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | OZF29_RS12665 | Protein ID | WP_023894767.1 |
| Coordinates | 2612085..2612189 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2611770..2611910 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZF29_RS12650 (2607332) | 2607332..2608045 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| OZF29_RS12655 (2608306) | 2608306..2611050 | + | 2745 | WP_116495149.1 | glycosyl hydrolase family 65 protein | - |
| OZF29_RS12660 (2611065) | 2611065..2611715 | + | 651 | WP_002415627.1 | beta-phosphoglucomutase | - |
| - (2611770) | 2611770..2611910 | + | 141 | NuclAT_6 | - | Antitoxin |
| - (2611966) | 2611966..2612107 | + | 142 | NuclAT_16 | - | - |
| - (2611966) | 2611966..2612152 | + | 187 | NuclAT_1 | - | - |
| OZF29_RS12665 (2612085) | 2612085..2612189 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| - (2612341) | 2612341..2612475 | + | 135 | NuclAT_17 | - | - |
| - (2612329) | 2612329..2612478 | + | 150 | NuclAT_3 | - | - |
| OZF29_RS12670 (2612751) | 2612751..2613344 | + | 594 | WP_161970597.1 | PBECR4 domain-containing protein | - |
| - (2613467) | 2613467..2613607 | + | 141 | NuclAT_4 | - | - |
| OZF29_RS12675 (2614106) | 2614106..2614639 | + | 534 | WP_002416003.1 | CPBP family intramembrane metalloprotease | - |
| OZF29_RS12680 (2614693) | 2614693..2615664 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| OZF29_RS12685 (2615839) | 2615839..2616276 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| OZF29_RS12690 (2616409) | 2616409..2616963 | - | 555 | WP_002378827.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T266112 WP_023894767.1 NZ_CP113832:c2612189-2612085 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 141 bp
>AT266112 NZ_CP113832:2611770-2611910 [Enterococcus faecalis]
TGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACGTACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTTGA
ATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAA
TGCTAGAATGTAGATGAAAAGAGAGATATGCGTCAACGTACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTTGA
ATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|