Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 338807..339002 | Replicon | chromosome |
Accession | NZ_CP113832 | ||
Organism | Enterococcus faecalis strain M61 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | OZF29_RS01750 | Protein ID | WP_015543884.1 |
Coordinates | 338907..339002 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 338807..338872 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZF29_RS01735 (334433) | 334433..336181 | + | 1749 | WP_161970589.1 | PTS transporter subunit EIIC | - |
OZF29_RS01740 (336172) | 336172..338205 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
OZF29_RS01745 (338216) | 338216..338650 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (338807) | 338807..338872 | + | 66 | NuclAT_21 | - | Antitoxin |
OZF29_RS01750 (338907) | 338907..339002 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
OZF29_RS01755 (339248) | 339248..341020 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
OZF29_RS01760 (341035) | 341035..341472 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
OZF29_RS01765 (341487) | 341487..342641 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
OZF29_RS01770 (342710) | 342710..343825 | - | 1116 | WP_116495098.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T266102 WP_015543884.1 NZ_CP113832:c339002-338907 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT266102 NZ_CP113832:338807-338872 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|