Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2933004..2933340 | Replicon | chromosome |
Accession | NZ_CP113831 | ||
Organism | Enterococcus faecalis strain T30 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | OZE10_RS14850 | Protein ID | WP_002396786.1 |
Coordinates | 2933004..2933147 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2933291..2933340 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE10_RS14830 (2928121) | 2928121..2928336 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
OZE10_RS14835 (2928475) | 2928475..2929467 | + | 993 | WP_023894581.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OZE10_RS14840 (2929731) | 2929731..2930369 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
OZE10_RS14845 (2931055) | 2931055..2932671 | + | 1617 | WP_047648929.1 | phosphatase PAP2/LCP family protein | - |
OZE10_RS14850 (2933004) | 2933004..2933147 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2933291) | 2933291..2933340 | + | 50 | NuclAT_14 | - | Antitoxin |
- (2933079) | 2933079..2933341 | - | 263 | NuclAT_11 | - | - |
OZE10_RS14855 (2933342) | 2933342..2938033 | - | 4692 | WP_047648930.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T266101 WP_002396786.1 NZ_CP113831:2933004-2933147 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT266101 NZ_CP113831:2933291-2933340 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|