Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 2042254..2042553 | Replicon | chromosome |
Accession | NC_017338 | ||
Organism | Staphylococcus aureus subsp. aureus JKD6159 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAA6159_RS14810 | Protein ID | WP_011447039.1 |
Coordinates | 2042377..2042553 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2042254..2042309 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAA6159_RS10120 | 2037585..2037845 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAA6159_RS10125 | 2037898..2038248 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
SAA6159_RS10130 | 2038933..2039382 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAA6159_RS15145 | 2039477..2039812 | - | 336 | Protein_1921 | SH3 domain-containing protein | - |
SAA6159_RS10140 | 2040462..2040953 | - | 492 | WP_000919350.1 | staphylokinase | - |
SAA6159_RS10145 | 2041144..2041899 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAA6159_RS10150 | 2041911..2042165 | - | 255 | WP_000611512.1 | phage holin | - |
SAA6159_RS10155 | 2042217..2042324 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2042246..2042385 | + | 140 | NuclAT_0 | - | - |
- | 2042246..2042385 | + | 140 | NuclAT_0 | - | - |
- | 2042246..2042385 | + | 140 | NuclAT_0 | - | - |
- | 2042246..2042385 | + | 140 | NuclAT_0 | - | - |
- | 2042254..2042309 | + | 56 | - | - | Antitoxin |
SAA6159_RS14810 | 2042377..2042553 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAA6159_RS10165 | 2042703..2042999 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAA6159_RS10170 | 2043057..2043344 | - | 288 | WP_001040261.1 | hypothetical protein | - |
SAA6159_RS10175 | 2043391..2043543 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAA6159_RS10180 | 2043533..2047318 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2037898..2088923 | 51025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T26610 WP_011447039.1 NC_017338:c2042553-2042377 [Staphylococcus aureus subsp. aureus JKD6159]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T26610 NC_017338:c2042553-2042377 [Staphylococcus aureus subsp. aureus JKD6159]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26610 NC_017338:2042254-2042309 [Staphylococcus aureus subsp. aureus JKD6159]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|