Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2854674..2855116 | Replicon | chromosome |
Accession | NZ_CP113831 | ||
Organism | Enterococcus faecalis strain T30 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | OZE10_RS14500 | Protein ID | WP_023894767.1 |
Coordinates | 2854674..2854778 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2854918..2855116 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OZE10_RS14485 (2849920) | 2849920..2850633 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
OZE10_RS14490 (2850895) | 2850895..2853639 | + | 2745 | WP_047648974.1 | glycosyl hydrolase family 65 protein | - |
OZE10_RS14495 (2853654) | 2853654..2854304 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- (2854359) | 2854359..2854499 | + | 141 | NuclAT_10 | - | - |
- (2854555) | 2854555..2854700 | + | 146 | NuclAT_12 | - | - |
- (2854555) | 2854555..2854741 | + | 187 | NuclAT_9 | - | - |
OZE10_RS14500 (2854674) | 2854674..2854778 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
- (2854930) | 2854930..2855075 | + | 146 | NuclAT_13 | - | - |
- (2854918) | 2854918..2855116 | + | 199 | NuclAT_8 | - | Antitoxin |
OZE10_RS14505 (2855049) | 2855049..2855192 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
OZE10_RS14510 (2855424) | 2855424..2856395 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
OZE10_RS14515 (2856570) | 2856570..2857007 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
OZE10_RS14520 (2857140) | 2857140..2857694 | - | 555 | WP_002354869.1 | Maf family protein | - |
OZE10_RS14525 (2857719) | 2857719..2859851 | - | 2133 | WP_002378991.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T266094 WP_023894767.1 NZ_CP113831:c2854778-2854674 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 199 bp
>AT266094 NZ_CP113831:2854918-2855116 [Enterococcus faecalis]
TTTTTAGGGAAATGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGA
CGGTGACCGATTGTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
TTTTTAGGGAAATGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGA
CGGTGACCGATTGTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAATT
TCACAATCAGTGCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|