Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1884157..1884337 | Replicon | chromosome |
Accession | NC_017338 | ||
Organism | Staphylococcus aureus subsp. aureus JKD6159 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAA6159_RS15120 | Protein ID | WP_001801861.1 |
Coordinates | 1884157..1884252 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1884280..1884337 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAA6159_RS09125 | 1879949..1880575 | + | 627 | WP_000669040.1 | hypothetical protein | - |
SAA6159_RS09130 | 1880616..1880957 | + | 342 | WP_000627543.1 | DUF3969 family protein | - |
SAA6159_RS09135 | 1881058..1881630 | + | 573 | WP_000414213.1 | hypothetical protein | - |
SAA6159_RS09140 | 1881828..1882385 | - | 558 | WP_000864142.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAA6159_RS09145 | 1882571..1882756 | - | 186 | WP_000809858.1 | hypothetical protein | - |
SAA6159_RS09150 | 1882758..1882934 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAA6159_RS09155 | 1882945..1883328 | - | 384 | WP_000610001.1 | hypothetical protein | - |
SAA6159_RS09165 | 1883776..1884012 | - | 237 | WP_000251966.1 | IS3 family transposase | - |
SAA6159_RS15120 | 1884157..1884252 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1884280..1884337 | - | 58 | - | - | Antitoxin |
SAA6159_RS15125 | 1884375..1884524 | + | 150 | WP_103245980.1 | hypothetical protein | - |
SAA6159_RS15225 | 1884469..1884624 | + | 156 | WP_001215821.1 | hypothetical protein | - |
SAA6159_RS09170 | 1885180..1885623 | - | 444 | WP_000731415.1 | DUF1433 domain-containing protein | - |
SAA6159_RS14755 | 1885623..1886065 | - | 443 | Protein_1773 | DUF1433 domain-containing protein | - |
SAA6159_RS09180 | 1886065..1886508 | - | 444 | WP_000747793.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1883776..1884012 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26605 WP_001801861.1 NC_017338:1884157-1884252 [Staphylococcus aureus subsp. aureus JKD6159]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26605 NC_017338:1884157-1884252 [Staphylococcus aureus subsp. aureus JKD6159]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT26605 NC_017338:c1884337-1884280 [Staphylococcus aureus subsp. aureus JKD6159]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|