Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 1648117..1648763 | Replicon | chromosome |
| Accession | NZ_CP113789 | ||
| Organism | Klebsiella variicola subsp. tropica strain BSK_177V2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | OUI59_RS08200 | Protein ID | WP_074387047.1 |
| Coordinates | 1648416..1648763 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OUI59_RS08195 | Protein ID | WP_074387048.1 |
| Coordinates | 1648117..1648416 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OUI59_RS08175 (OUI59_08175) | 1644324..1645082 | - | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
| OUI59_RS08180 (OUI59_08180) | 1645132..1645962 | - | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
| OUI59_RS08185 (OUI59_08185) | 1646013..1646342 | - | 330 | WP_032733885.1 | thiosulfate sulfurtransferase GlpE | - |
| OUI59_RS08190 (OUI59_08190) | 1646546..1648054 | + | 1509 | WP_074387049.1 | glycerol-3-phosphate dehydrogenase | - |
| OUI59_RS08195 (OUI59_08195) | 1648117..1648416 | - | 300 | WP_074387048.1 | XRE family transcriptional regulator | Antitoxin |
| OUI59_RS08200 (OUI59_08200) | 1648416..1648763 | - | 348 | WP_074387047.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OUI59_RS08205 (OUI59_08205) | 1648978..1651425 | - | 2448 | WP_061153092.1 | glycogen phosphorylase | - |
| OUI59_RS08210 (OUI59_08210) | 1651443..1652876 | - | 1434 | WP_061153091.1 | glycogen synthase GlgA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13518.59 Da Isoelectric Point: 6.7217
>T266045 WP_074387047.1 NZ_CP113789:c1648763-1648416 [Klebsiella variicola subsp. tropica]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
ILCAGNKDGMNEKRFYKEMITLADREFSKHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
ILCAGNKDGMNEKRFYKEMITLADREFSKHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|