Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1776343..1776938 | Replicon | chromosome |
Accession | NZ_CP113783 | ||
Organism | Pseudoxanthomonas sp. SE1 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | OY559_RS08405 | Protein ID | WP_277729574.1 |
Coordinates | 1776343..1776624 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OY559_RS08410 | Protein ID | WP_093297534.1 |
Coordinates | 1776648..1776938 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OY559_RS08400 (OY559_08405) | 1772314..1775958 | + | 3645 | WP_277729573.1 | methylmalonyl-CoA mutase family protein | - |
OY559_RS08405 (OY559_08410) | 1776343..1776624 | + | 282 | WP_277729574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OY559_RS08410 (OY559_08415) | 1776648..1776938 | + | 291 | WP_093297534.1 | HigA family addiction module antitoxin | Antitoxin |
OY559_RS08415 (OY559_08420) | 1777136..1777438 | + | 303 | WP_277729575.1 | type II toxin-antitoxin system HigB family toxin | - |
OY559_RS08420 (OY559_08425) | 1777435..1777794 | + | 360 | WP_277729576.1 | transcriptional regulator | - |
OY559_RS08425 (OY559_08430) | 1777985..1778272 | - | 288 | WP_277729577.1 | hypothetical protein | - |
OY559_RS08430 (OY559_08435) | 1778509..1778865 | - | 357 | WP_277729578.1 | cell envelope integrity protein TolA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10746.26 Da Isoelectric Point: 10.5447
>T266026 WP_277729574.1 NZ_CP113783:1776343-1776624 [Pseudoxanthomonas sp. SE1]
VIRDFADKEAEKVWNGTPSRRLPADMQAVARRKLRMLNNAATLDDLRIPPANRLEVLKGDRKGQHSIRINDQWRVCFRWK
GGDAHGVDIVDYH
VIRDFADKEAEKVWNGTPSRRLPADMQAVARRKLRMLNNAATLDDLRIPPANRLEVLKGDRKGQHSIRINDQWRVCFRWK
GGDAHGVDIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|