Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4649029..4649783 | Replicon | chromosome |
| Accession | NZ_CP113541 | ||
| Organism | Salmonella enterica strain CHC | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OXV05_RS22350 | Protein ID | WP_000558166.1 |
| Coordinates | 4649029..4649340 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV05_RS22355 | Protein ID | WP_001259011.1 |
| Coordinates | 4649337..4649783 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV05_RS22320 (4644687) | 4644687..4645589 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV05_RS22325 (4645586) | 4645586..4646221 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV05_RS22330 (4646218) | 4646218..4647147 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV05_RS22335 (4647194) | 4647194..4647484 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV05_RS22340 (4647485) | 4647485..4647796 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV05_RS22345 (4648014) | 4648014..4648943 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| OXV05_RS22350 (4649029) | 4649029..4649340 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV05_RS22355 (4649337) | 4649337..4649783 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV05_RS22360 (4649798) | 4649798..4650739 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV05_RS22365 (4650784) | 4650784..4651221 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| OXV05_RS22370 (4651218) | 4651218..4652090 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| OXV05_RS22375 (4652084) | 4652084..4652683 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV05_RS22380 (4652874) | 4652874..4653677 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV05_RS22385 (4653711) | 4653711..4654607 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T266024 WP_000558166.1 NZ_CP113541:4649029-4649340 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT266024 WP_001259011.1 NZ_CP113541:4649337-4649783 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|