Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2384926..2385448 | Replicon | chromosome |
| Accession | NZ_CP113541 | ||
| Organism | Salmonella enterica strain CHC | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | OXV05_RS11465 | Protein ID | WP_000221343.1 |
| Coordinates | 2385164..2385448 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | OXV05_RS11460 | Protein ID | WP_000885424.1 |
| Coordinates | 2384926..2385174 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV05_RS11435 (2380142) | 2380142..2381608 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
| OXV05_RS11440 (2382416) | 2382416..2383130 | + | 715 | Protein_2236 | helix-turn-helix domain-containing protein | - |
| OXV05_RS11445 (2383186) | 2383186..2384094 | - | 909 | WP_010989018.1 | hypothetical protein | - |
| OXV05_RS11450 (2384237) | 2384237..2384569 | - | 333 | WP_198903240.1 | DUF1493 family protein | - |
| OXV05_RS11455 (2384559) | 2384559..2384774 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| OXV05_RS11460 (2384926) | 2384926..2385174 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OXV05_RS11465 (2385164) | 2385164..2385448 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OXV05_RS11470 (2385619) | 2385619..2386008 | + | 390 | WP_000194089.1 | RidA family protein | - |
| OXV05_RS11475 (2386060) | 2386060..2387139 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| OXV05_RS11480 (2387332) | 2387332..2387820 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OXV05_RS11485 (2387865) | 2387865..2389373 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2380145..2392230 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T266016 WP_000221343.1 NZ_CP113541:2385164-2385448 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |