Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2525003..2525187 | Replicon | chromosome |
Accession | NC_017337 | ||
Organism | Staphylococcus aureus subsp. aureus ED133 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAOV_RS13045 | Protein ID | WP_000482647.1 |
Coordinates | 2525080..2525187 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2525003..2525063 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAOV_RS13020 | 2520457..2520624 | - | 168 | WP_041204334.1 | hypothetical protein | - |
SAOV_RS13030 | 2520855..2522588 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
SAOV_RS13035 | 2522613..2524376 | - | 1764 | WP_001064817.1 | ABC transporter ATP-binding protein/permease | - |
- | 2525003..2525063 | + | 61 | - | - | Antitoxin |
SAOV_RS13045 | 2525080..2525187 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAOV_RS13050 | 2525320..2525706 | - | 387 | WP_000779350.1 | flippase GtxA | - |
SAOV_RS13055 | 2525974..2527116 | + | 1143 | WP_001176868.1 | glycerate kinase | - |
SAOV_RS13060 | 2527176..2527835 | + | 660 | WP_000831299.1 | hypothetical protein | - |
SAOV_RS13065 | 2528021..2529232 | + | 1212 | WP_001191928.1 | multidrug effflux MFS transporter | - |
SAOV_RS13070 | 2529355..2529828 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T26601 WP_000482647.1 NC_017337:c2525187-2525080 [Staphylococcus aureus subsp. aureus ED133]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T26601 NC_017337:c2525187-2525080 [Staphylococcus aureus subsp. aureus ED133]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26601 NC_017337:2525003-2525063 [Staphylococcus aureus subsp. aureus ED133]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|