Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4524544..4525298 | Replicon | chromosome |
| Accession | NZ_CP113540 | ||
| Organism | Salmonella enterica strain CYX | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | OXV10_RS22060 | Protein ID | WP_000558168.1 |
| Coordinates | 4524544..4524855 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV10_RS22065 | Protein ID | WP_001259009.1 |
| Coordinates | 4524852..4525298 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV10_RS22030 (4520202) | 4520202..4521104 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| OXV10_RS22035 (4521101) | 4521101..4521736 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV10_RS22040 (4521733) | 4521733..4522662 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV10_RS22045 (4522709) | 4522709..4522999 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV10_RS22050 (4523000) | 4523000..4523311 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV10_RS22055 (4523529) | 4523529..4524458 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| OXV10_RS22060 (4524544) | 4524544..4524855 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV10_RS22065 (4524852) | 4524852..4525298 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV10_RS22070 (4525313) | 4525313..4526254 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV10_RS22075 (4526299) | 4526299..4526736 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| OXV10_RS22080 (4526733) | 4526733..4527605 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| OXV10_RS22085 (4527599) | 4527599..4528198 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV10_RS22090 (4528389) | 4528389..4529192 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV10_RS22095 (4529226) | 4529226..4530122 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T266005 WP_000558168.1 NZ_CP113540:4524544-4524855 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT266005 WP_001259009.1 NZ_CP113540:4524852-4525298 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|