Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4522709..4523311 | Replicon | chromosome |
Accession | NZ_CP113540 | ||
Organism | Salmonella enterica strain CYX |
Toxin (Protein)
Gene name | higB | Uniprot ID | M7S4R6 |
Locus tag | OXV10_RS22050 | Protein ID | WP_001159635.1 |
Coordinates | 4523000..4523311 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OXV10_RS22045 | Protein ID | WP_000362050.1 |
Coordinates | 4522709..4522999 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV10_RS22030 (4520202) | 4520202..4521104 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
OXV10_RS22035 (4521101) | 4521101..4521736 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
OXV10_RS22040 (4521733) | 4521733..4522662 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
OXV10_RS22045 (4522709) | 4522709..4522999 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
OXV10_RS22050 (4523000) | 4523000..4523311 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
OXV10_RS22055 (4523529) | 4523529..4524458 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
OXV10_RS22060 (4524544) | 4524544..4524855 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | - |
OXV10_RS22065 (4524852) | 4524852..4525298 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
OXV10_RS22070 (4525313) | 4525313..4526254 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
OXV10_RS22075 (4526299) | 4526299..4526736 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
OXV10_RS22080 (4526733) | 4526733..4527605 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
OXV10_RS22085 (4527599) | 4527599..4528198 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12340.30 Da Isoelectric Point: 9.4460
>T266004 WP_001159635.1 NZ_CP113540:c4523311-4523000 [Salmonella enterica]
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDEDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|