Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2478027..2478252 | Replicon | chromosome |
Accession | NZ_CP113540 | ||
Organism | Salmonella enterica strain CYX |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | OXV10_RS12135 | Protein ID | WP_000813254.1 |
Coordinates | 2478027..2478182 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2478194..2478252 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV10_RS12100 | 2473134..2473415 | - | 282 | WP_000445513.1 | phage holin family protein | - |
OXV10_RS12105 | 2473405..2473593 | - | 189 | WP_001688615.1 | putative holin | - |
OXV10_RS12110 | 2473587..2473910 | - | 324 | Protein_2372 | tellurite/colicin resistance protein | - |
OXV10_RS12115 | 2476081..2476617 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
OXV10_RS12120 | 2476614..2476904 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
OXV10_RS12125 | 2476904..2477503 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
OXV10_RS12130 | 2477566..2477736 | - | 171 | WP_000734094.1 | hypothetical protein | - |
OXV10_RS12135 | 2478027..2478182 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 2478194..2478252 | + | 59 | - | - | Antitoxin |
OXV10_RS12140 | 2478609..2479541 | + | 933 | WP_000556390.1 | hypothetical protein | - |
OXV10_RS12145 | 2479538..2480092 | + | 555 | WP_001033796.1 | hypothetical protein | - |
OXV10_RS12150 | 2480254..2480583 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
OXV10_RS12155 | 2480627..2480674 | - | 48 | Protein_2381 | hypothetical protein | - |
OXV10_RS12160 | 2480856..2481323 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
OXV10_RS12165 | 2481708..2481863 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
OXV10_RS12170 | 2481971..2482492 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
OXV10_RS12175 | 2482930..2483151 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2472592..2484463 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T265992 WP_000813254.1 NZ_CP113540:c2478182-2478027 [Salmonella enterica]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT265992 NZ_CP113540:2478194-2478252 [Salmonella enterica]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|