Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4531476..4532230 | Replicon | chromosome |
| Accession | NZ_CP113539 | ||
| Organism | Salmonella enterica strain FFL | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | OXV09_RS21860 | Protein ID | WP_000558163.1 |
| Coordinates | 4531476..4531787 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV09_RS21865 | Protein ID | WP_001259011.1 |
| Coordinates | 4531784..4532230 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV09_RS21830 (4527134) | 4527134..4528036 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV09_RS21835 (4528033) | 4528033..4528668 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV09_RS21840 (4528665) | 4528665..4529594 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV09_RS21845 (4529641) | 4529641..4529931 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV09_RS21850 (4529932) | 4529932..4530243 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV09_RS21855 (4530461) | 4530461..4531390 | + | 930 | WP_023255277.1 | alpha/beta hydrolase | - |
| OXV09_RS21860 (4531476) | 4531476..4531787 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV09_RS21865 (4531784) | 4531784..4532230 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV09_RS21870 (4532245) | 4532245..4533186 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV09_RS21875 (4533231) | 4533231..4533668 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| OXV09_RS21880 (4533665) | 4533665..4534537 | - | 873 | WP_023255278.1 | virulence factor BrkB family protein | - |
| OXV09_RS21885 (4534531) | 4534531..4535130 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV09_RS21890 (4535321) | 4535321..4536124 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV09_RS21895 (4536158) | 4536158..4537054 | - | 897 | WP_001651900.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T265985 WP_000558163.1 NZ_CP113539:4531476-4531787 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265985 WP_001259011.1 NZ_CP113539:4531784-4532230 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|