Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2328839..2329361 | Replicon | chromosome |
| Accession | NZ_CP113539 | ||
| Organism | Salmonella enterica strain FFL | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | OXV09_RS11215 | Protein ID | WP_000221343.1 |
| Coordinates | 2329077..2329361 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | OXV09_RS11210 | Protein ID | WP_000885424.1 |
| Coordinates | 2328839..2329087 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV09_RS11185 (2324932) | 2324932..2326398 | + | 1467 | WP_077946914.1 | hypothetical protein | - |
| OXV09_RS11190 (2326700) | 2326700..2326990 | + | 291 | WP_000742001.1 | hypothetical protein | - |
| OXV09_RS11195 (2327343) | 2327343..2328069 | + | 727 | Protein_2188 | helix-turn-helix domain-containing protein | - |
| OXV09_RS11200 (2328150) | 2328150..2328482 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| OXV09_RS11205 (2328472) | 2328472..2328687 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| OXV09_RS11210 (2328839) | 2328839..2329087 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OXV09_RS11215 (2329077) | 2329077..2329361 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OXV09_RS11220 (2329532) | 2329532..2329921 | + | 390 | WP_000194089.1 | RidA family protein | - |
| OXV09_RS11225 (2329973) | 2329973..2331052 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| OXV09_RS11230 (2331245) | 2331245..2331733 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OXV09_RS11235 (2331778) | 2331778..2333286 | + | 1509 | WP_058214747.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2324935..2336143 | 11208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T265977 WP_000221343.1 NZ_CP113539:2329077-2329361 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |