Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4655766..4656520 | Replicon | chromosome |
| Accession | NZ_CP113538 | ||
| Organism | Salmonella enterica strain XSK | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OXV06_RS22410 | Protein ID | WP_000558166.1 |
| Coordinates | 4655766..4656077 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV06_RS22415 | Protein ID | WP_001259011.1 |
| Coordinates | 4656074..4656520 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV06_RS22380 (4651424) | 4651424..4652326 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV06_RS22385 (4652323) | 4652323..4652958 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV06_RS22390 (4652955) | 4652955..4653884 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV06_RS22395 (4653931) | 4653931..4654221 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV06_RS22400 (4654222) | 4654222..4654533 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV06_RS22405 (4654751) | 4654751..4655680 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| OXV06_RS22410 (4655766) | 4655766..4656077 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV06_RS22415 (4656074) | 4656074..4656520 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV06_RS22420 (4656535) | 4656535..4657476 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV06_RS22425 (4657521) | 4657521..4657958 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| OXV06_RS22430 (4657955) | 4657955..4658827 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| OXV06_RS22435 (4658821) | 4658821..4659420 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV06_RS22440 (4659611) | 4659611..4660414 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV06_RS22445 (4660448) | 4660448..4661344 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T265968 WP_000558166.1 NZ_CP113538:4655766-4656077 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265968 WP_001259011.1 NZ_CP113538:4656074-4656520 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|