Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4484606..4485360 | Replicon | chromosome |
| Accession | NZ_CP113537 | ||
| Organism | Salmonella enterica strain YZY | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | OXV04_RS21380 | Protein ID | WP_000558163.1 |
| Coordinates | 4484606..4484917 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV04_RS21385 | Protein ID | WP_001259009.1 |
| Coordinates | 4484914..4485360 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV04_RS21350 (4480264) | 4480264..4481166 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| OXV04_RS21355 (4481163) | 4481163..4481798 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV04_RS21360 (4481795) | 4481795..4482724 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV04_RS21365 (4482771) | 4482771..4483061 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV04_RS21370 (4483062) | 4483062..4483373 | - | 312 | WP_023138876.1 | hypothetical protein | - |
| OXV04_RS21375 (4483591) | 4483591..4484520 | + | 930 | WP_126524392.1 | alpha/beta hydrolase | - |
| OXV04_RS21380 (4484606) | 4484606..4484917 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV04_RS21385 (4484914) | 4484914..4485360 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV04_RS21390 (4485375) | 4485375..4486316 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV04_RS21395 (4486361) | 4486361..4486798 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| OXV04_RS21400 (4486795) | 4486795..4487667 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| OXV04_RS21405 (4487661) | 4487661..4488260 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV04_RS21410 (4488451) | 4488451..4489254 | - | 804 | WP_021000967.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV04_RS21415 (4489288) | 4489288..4490184 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T265949 WP_000558163.1 NZ_CP113537:4484606-4484917 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT265949 WP_001259009.1 NZ_CP113537:4484914-4485360 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|