Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4660256..4661010 | Replicon | chromosome |
| Accession | NZ_CP113536 | ||
| Organism | Salmonella enterica strain ZCX | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OXV07_RS22615 | Protein ID | WP_000558166.1 |
| Coordinates | 4660256..4660567 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV07_RS22620 | Protein ID | WP_001259011.1 |
| Coordinates | 4660564..4661010 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV07_RS22585 (4655914) | 4655914..4656816 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV07_RS22590 (4656813) | 4656813..4657448 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV07_RS22595 (4657445) | 4657445..4658374 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV07_RS22600 (4658421) | 4658421..4658711 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV07_RS22605 (4658712) | 4658712..4659023 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV07_RS22610 (4659241) | 4659241..4660170 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| OXV07_RS22615 (4660256) | 4660256..4660567 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV07_RS22620 (4660564) | 4660564..4661010 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV07_RS22625 (4661025) | 4661025..4661966 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV07_RS22630 (4662011) | 4662011..4662448 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| OXV07_RS22635 (4662445) | 4662445..4663317 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| OXV07_RS22640 (4663311) | 4663311..4663910 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV07_RS22645 (4664101) | 4664101..4664904 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV07_RS22650 (4664938) | 4664938..4665834 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T265934 WP_000558166.1 NZ_CP113536:4660256-4660567 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265934 WP_001259011.1 NZ_CP113536:4660564-4661010 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|