Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1884295..1884475 | Replicon | chromosome |
Accession | NC_017337 | ||
Organism | Staphylococcus aureus subsp. aureus ED133 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAOV_RS15340 | Protein ID | WP_001801861.1 |
Coordinates | 1884295..1884390 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1884418..1884475 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAOV_RS09335 | 1879699..1880325 | + | 627 | WP_000669034.1 | hypothetical protein | - |
SAOV_RS09340 | 1880366..1880707 | + | 342 | WP_000627544.1 | DUF3969 family protein | - |
SAOV_RS09345 | 1880808..1881380 | + | 573 | WP_000414210.1 | hypothetical protein | - |
SAOV_RS09350 | 1881756..1882592 | + | 837 | WP_000190484.1 | ABC transporter ATP-binding protein | - |
SAOV_RS09360 | 1883398..1883844 | - | 447 | WP_000747806.1 | DUF1433 domain-containing protein | - |
SAOV_RS15340 | 1884295..1884390 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1884418..1884475 | - | 58 | - | - | Antitoxin |
SAOV_RS09365 | 1884513..1884614 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAOV_RS14985 | 1884600..1884779 | - | 180 | Protein_1804 | transposase | - |
SAOV_RS09370 | 1884967..1885341 | - | 375 | WP_000695817.1 | DUF1433 domain-containing protein | - |
SAOV_RS09375 | 1885331..1885711 | - | 381 | WP_001035978.1 | DUF1433 domain-containing protein | - |
SAOV_RS09380 | 1885919..1886359 | - | 441 | WP_000759945.1 | DUF1433 domain-containing protein | - |
SAOV_RS09385 | 1886404..1888017 | + | 1614 | WP_000926709.1 | hypothetical protein | - |
SAOV_RS09390 | 1888032..1888331 | + | 300 | WP_000095391.1 | WXG100 family type VII secretion target | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26593 WP_001801861.1 NC_017337:1884295-1884390 [Staphylococcus aureus subsp. aureus ED133]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26593 NC_017337:1884295-1884390 [Staphylococcus aureus subsp. aureus ED133]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT26593 NC_017337:c1884475-1884418 [Staphylococcus aureus subsp. aureus ED133]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|