Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4777124..4777878 | Replicon | chromosome |
| Accession | NZ_CP113535 | ||
| Organism | Salmonella enterica strain ZLQ | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | OXV11_RS23480 | Protein ID | WP_000558166.1 |
| Coordinates | 4777124..4777435 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV11_RS23485 | Protein ID | WP_001259011.1 |
| Coordinates | 4777432..4777878 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV11_RS23450 (4772782) | 4772782..4773684 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV11_RS23455 (4773681) | 4773681..4774316 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV11_RS23460 (4774313) | 4774313..4775242 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV11_RS23465 (4775289) | 4775289..4775579 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV11_RS23470 (4775580) | 4775580..4775891 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV11_RS23475 (4776109) | 4776109..4777038 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| OXV11_RS23480 (4777124) | 4777124..4777435 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV11_RS23485 (4777432) | 4777432..4777878 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV11_RS23490 (4777893) | 4777893..4778834 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV11_RS23495 (4778879) | 4778879..4779316 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| OXV11_RS23500 (4779313) | 4779313..4780185 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| OXV11_RS23505 (4780179) | 4780179..4780778 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV11_RS23510 (4780969) | 4780969..4781772 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV11_RS23515 (4781806) | 4781806..4782702 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T265915 WP_000558166.1 NZ_CP113535:4777124-4777435 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265915 WP_001259011.1 NZ_CP113535:4777432-4777878 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|