Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2484904..2485426 | Replicon | chromosome |
| Accession | NZ_CP113535 | ||
| Organism | Salmonella enterica strain ZLQ | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | OXV11_RS12215 | Protein ID | WP_000221343.1 |
| Coordinates | 2485142..2485426 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | V1H457 |
| Locus tag | OXV11_RS12210 | Protein ID | WP_000885424.1 |
| Coordinates | 2484904..2485152 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV11_RS12185 (2480120) | 2480120..2481586 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
| OXV11_RS12190 (2482394) | 2482394..2483108 | + | 715 | Protein_2386 | helix-turn-helix domain-containing protein | - |
| OXV11_RS12195 (2483164) | 2483164..2484072 | - | 909 | WP_010989018.1 | hypothetical protein | - |
| OXV11_RS12200 (2484215) | 2484215..2484547 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| OXV11_RS12205 (2484537) | 2484537..2484752 | - | 216 | WP_000206207.1 | hypothetical protein | - |
| OXV11_RS12210 (2484904) | 2484904..2485152 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OXV11_RS12215 (2485142) | 2485142..2485426 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OXV11_RS12220 (2485597) | 2485597..2485986 | + | 390 | WP_000194089.1 | RidA family protein | - |
| OXV11_RS12225 (2486038) | 2486038..2487117 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| OXV11_RS12230 (2487310) | 2487310..2487798 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| OXV11_RS12235 (2487843) | 2487843..2489351 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 2480123..2492208 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T265907 WP_000221343.1 NZ_CP113535:2485142-2485426 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0WPN5 |