Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4519421..4520175 | Replicon | chromosome |
| Accession | NZ_CP113534 | ||
| Organism | Salmonella enterica strain ZYX | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A3Z1E8E0 |
| Locus tag | OXV08_RS21810 | Protein ID | WP_000558163.1 |
| Coordinates | 4519421..4519732 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OXV08_RS21815 | Protein ID | WP_001259011.1 |
| Coordinates | 4519729..4520175 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV08_RS21780 (4515079) | 4515079..4515981 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| OXV08_RS21785 (4515978) | 4515978..4516613 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OXV08_RS21790 (4516610) | 4516610..4517539 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| OXV08_RS21795 (4517586) | 4517586..4517876 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| OXV08_RS21800 (4517877) | 4517877..4518188 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| OXV08_RS21805 (4518406) | 4518406..4519335 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| OXV08_RS21810 (4519421) | 4519421..4519732 | + | 312 | WP_000558163.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| OXV08_RS21815 (4519729) | 4519729..4520175 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| OXV08_RS21820 (4520190) | 4520190..4521131 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| OXV08_RS21825 (4521176) | 4521176..4521613 | - | 438 | WP_001621365.1 | D-aminoacyl-tRNA deacylase | - |
| OXV08_RS21830 (4521610) | 4521610..4522482 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| OXV08_RS21835 (4522476) | 4522476..4523075 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| OXV08_RS21840 (4523266) | 4523266..4524069 | - | 804 | WP_001728053.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| OXV08_RS21845 (4524103) | 4524103..4524999 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.36 Da Isoelectric Point: 9.5921
>T265896 WP_000558163.1 NZ_CP113534:4519421-4519732 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT265896 WP_001259011.1 NZ_CP113534:4519729-4520175 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|