Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2262232..2262807 Replicon chromosome
Accession NZ_CP113517
Organism Methylomonas rapida strain MP1

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag NM686_RS10670 Protein ID WP_255187855.1
Coordinates 2262529..2262807 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NM686_RS10665 Protein ID WP_255187854.1
Coordinates 2262232..2262516 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NM686_RS10610 (NM686_010610) 2257518..2258345 - 828 WP_255187843.1 hypothetical protein -
NM686_RS10615 (NM686_010615) 2258311..2258871 - 561 WP_255187844.1 hypothetical protein -
NM686_RS10620 (NM686_010620) 2258936..2259181 + 246 WP_269022862.1 hypothetical protein -
NM686_RS10625 (NM686_010625) 2259192..2259458 + 267 WP_255187846.1 LuxR C-terminal-related transcriptional regulator -
NM686_RS10630 (NM686_010630) 2259462..2259608 + 147 WP_255187847.1 hypothetical protein -
NM686_RS10635 (NM686_010635) 2259605..2259766 + 162 WP_255187848.1 hypothetical protein -
NM686_RS10640 (NM686_010640) 2259763..2259906 + 144 WP_255187849.1 hypothetical protein -
NM686_RS10645 (NM686_010645) 2259899..2260525 + 627 WP_255187850.1 Rha family transcriptional regulator -
NM686_RS10650 (NM686_010650) 2260553..2261176 + 624 WP_255187851.1 Rha family transcriptional regulator -
NM686_RS10655 (NM686_010655) 2261234..2261908 + 675 WP_255187852.1 KilA-N domain-containing protein -
NM686_RS10660 (NM686_010660) 2261976..2262206 + 231 WP_255187853.1 hypothetical protein -
NM686_RS10665 (NM686_010665) 2262232..2262516 - 285 WP_255187854.1 HigA family addiction module antitoxin Antitoxin
NM686_RS10670 (NM686_010670) 2262529..2262807 - 279 WP_255187855.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NM686_RS10675 (NM686_010675) 2262877..2263275 - 399 WP_255187856.1 hypothetical protein -
NM686_RS10680 (NM686_010680) 2263290..2263550 + 261 WP_255187857.1 hypothetical protein -
NM686_RS10685 (NM686_010685) 2263543..2264454 + 912 WP_255187858.1 KilA-N domain-containing protein -
NM686_RS10690 (NM686_010690) 2264511..2265332 + 822 WP_269022868.1 BRO family protein -
NM686_RS10695 (NM686_010695) 2265341..2266186 + 846 WP_255187860.1 toprim domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2232653..2284763 52110


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(3-92)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(1-83)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10417.03 Da        Isoelectric Point: 8.5520

>T265864 WP_255187855.1 NZ_CP113517:c2262807-2262529 [Methylomonas rapida]
MIKSFTHKGLEKFFTTGSQAGIQAIHAKRLRLILALLNDARELSDLNAPALKLHGLKGDLAGFWAVTVQANWRVIFRFED
GDVYVVDYLDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10315.86 Da        Isoelectric Point: 5.0775

>AT265864 WP_255187854.1 NZ_CP113517:c2262516-2262232 [Methylomonas rapida]
MRMFNPPHPGEILADLWLEPLGLSITETAKALNVSRKALSELVNGKTALSPEMAVRLELAFGKSAESWLAAQAAYDVWQW
EAKRDSLGVHELAA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References