Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2563849..2564033 | Replicon | chromosome |
Accession | NC_017333 | ||
Organism | Staphylococcus aureus subsp. aureus ST398 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SAPIG_RS13060 | Protein ID | WP_000482647.1 |
Coordinates | 2563926..2564033 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2563849..2563909 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAPIG_RS13035 | 2559303..2559470 | - | 168 | WP_001798790.1 | hypothetical protein | - |
SAPIG_RS13045 | 2559701..2561434 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
SAPIG_RS13050 | 2561459..2563222 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
- | 2563849..2563909 | + | 61 | - | - | Antitoxin |
SAPIG_RS13060 | 2563926..2564033 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAPIG_RS13065 | 2564167..2564553 | - | 387 | WP_000779355.1 | flippase GtxA | - |
SAPIG_RS13070 | 2564820..2565962 | + | 1143 | WP_001176859.1 | glycerate kinase | - |
SAPIG_RS13075 | 2566022..2566681 | + | 660 | WP_000831300.1 | hypothetical protein | - |
SAPIG_RS13080 | 2566869..2568080 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
SAPIG_RS13085 | 2568203..2568676 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T26586 WP_000482647.1 NC_017333:c2564033-2563926 [Staphylococcus aureus subsp. aureus ST398]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T26586 NC_017333:c2564033-2563926 [Staphylococcus aureus subsp. aureus ST398]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26586 NC_017333:2563849-2563909 [Staphylococcus aureus subsp. aureus ST398]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|