Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1017878..1018572 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | - |
Locus tag | OWC53_RS04710 | Protein ID | WP_039283807.1 |
Coordinates | 1018168..1018572 (+) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | - |
Locus tag | OWC53_RS04705 | Protein ID | WP_040033545.1 |
Coordinates | 1017878..1018171 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS04690 (OWC53_04685) | 1014867..1016183 | - | 1317 | WP_268198371.1 | cytosine permease | - |
OWC53_RS04695 (OWC53_04690) | 1016198..1016887 | - | 690 | WP_039283802.1 | LuxR C-terminal-related transcriptional regulator | - |
OWC53_RS04700 (OWC53_04695) | 1016917..1017330 | - | 414 | WP_039272788.1 | GNAT family N-acetyltransferase | - |
OWC53_RS04705 (OWC53_04700) | 1017878..1018171 | + | 294 | WP_040033545.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OWC53_RS04710 (OWC53_04705) | 1018168..1018572 | + | 405 | WP_039283807.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
OWC53_RS04715 (OWC53_04710) | 1018903..1021146 | + | 2244 | WP_040033546.1 | ferric-rhodotorulic acid/ferric-coprogen receptor FhuE | - |
OWC53_RS04720 (OWC53_04715) | 1021234..1022583 | - | 1350 | WP_205532609.1 | enolase C-terminal domain-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 15596.98 Da Isoelectric Point: 6.6368
>T265848 WP_039283807.1 NZ_CP113504:1018168-1018572 [Pectobacterium brasiliense]
MSIRIFKSTLLCQQLSQQELDDLVADFLSYKQDGVLPDTFGRDALYDDDRTYPLVREEQVAHIHLADANAPFPKFLRQFK
RTSDKAHLVYCQSAMDPDIYLLIIILKPEAHKMARDNNNMHKVGMMAEAFRMKY
MSIRIFKSTLLCQQLSQQELDDLVADFLSYKQDGVLPDTFGRDALYDDDRTYPLVREEQVAHIHLADANAPFPKFLRQFK
RTSDKAHLVYCQSAMDPDIYLLIIILKPEAHKMARDNNNMHKVGMMAEAFRMKY
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|