Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 432902..433626 | Replicon | chromosome |
Accession | NZ_CP113504 | ||
Organism | Pectobacterium brasiliense strain 21PCA_AGRO2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7V8TLN0 |
Locus tag | OWC53_RS01995 | Protein ID | WP_039504225.1 |
Coordinates | 432902..433213 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OWC53_RS02000 | Protein ID | WP_039504227.1 |
Coordinates | 433210..433626 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWC53_RS01975 (OWC53_01975) | 428831..430387 | - | 1557 | WP_039504219.1 | carbohydrate porin | - |
OWC53_RS01980 (OWC53_01980) | 430586..431509 | - | 924 | WP_205532751.1 | aminoimidazole riboside kinase | - |
OWC53_RS01985 (OWC53_01985) | 431834..432022 | + | 189 | WP_039504221.1 | hypothetical protein | - |
OWC53_RS01990 (OWC53_01990) | 432192..432743 | + | 552 | WP_268198113.1 | polymer-forming cytoskeletal protein | - |
OWC53_RS01995 (OWC53_01995) | 432902..433213 | + | 312 | WP_039504225.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
OWC53_RS02000 (OWC53_02000) | 433210..433626 | + | 417 | WP_039504227.1 | helix-turn-helix domain-containing protein | Antitoxin |
OWC53_RS02005 (OWC53_02005) | 433765..434136 | - | 372 | WP_039279503.1 | helix-turn-helix transcriptional regulator | - |
OWC53_RS02010 (OWC53_02010) | 434211..434471 | - | 261 | WP_039279236.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
OWC53_RS02015 (OWC53_02015) | 434773..435231 | + | 459 | WP_014913932.1 | hypothetical protein | - |
OWC53_RS02020 (OWC53_02020) | 435307..436659 | - | 1353 | WP_268198115.1 | pyridoxal-dependent decarboxylase | - |
OWC53_RS02025 (OWC53_02025) | 436714..437970 | - | 1257 | WP_268198116.1 | MFS transporter | - |
OWC53_RS02030 (OWC53_02030) | 438124..438570 | + | 447 | WP_014913935.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12406.28 Da Isoelectric Point: 10.0380
>T265841 WP_039504225.1 NZ_CP113504:432902-433213 [Pectobacterium brasiliense]
MHVISRAPFDTATTQFPNQAAALADLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
MHVISRAPFDTATTQFPNQAAALADLYRVIKREMYATPDDMKKRFPSLDRMKYREKWWVIDIGGGHLRVMFFADFERGKI
FIKHITSHAEYDRLTEYYRRNKE
Download Length: 312 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15405.66 Da Isoelectric Point: 4.6581
>AT265841 WP_039504227.1 NZ_CP113504:433210-433626 [Pectobacterium brasiliense]
MMYADAIKAANNLTSIVPFLGGSTSRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYENDAPEFAAFNERIKALPAGI
ALLRVLMDQHQLTQSDFEAEIGKKSLVSRILNGERTLTLDHMRALAKRFDIPVSAFVD
MMYADAIKAANNLTSIVPFLGGSTSRKDYEDALKLTEYLIESEPDSPLIDMLTAKIDKYENDAPEFAAFNERIKALPAGI
ALLRVLMDQHQLTQSDFEAEIGKKSLVSRILNGERTLTLDHMRALAKRFDIPVSAFVD
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|