Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4953287..4953889 | Replicon | chromosome |
| Accession | NZ_CP113503 | ||
| Organism | Escherichia coli strain 16843 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | OWO50_RS23705 | Protein ID | WP_000897305.1 |
| Coordinates | 4953578..4953889 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | OWO50_RS23700 | Protein ID | WP_000356397.1 |
| Coordinates | 4953287..4953577 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO50_RS23680 (4949789) | 4949789..4950691 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| OWO50_RS23685 (4950688) | 4950688..4951323 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| OWO50_RS23690 (4951320) | 4951320..4952249 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| OWO50_RS23695 (4952464) | 4952464..4952682 | - | 219 | WP_001298592.1 | CopG family transcriptional regulator | - |
| OWO50_RS23700 (4953287) | 4953287..4953577 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| OWO50_RS23705 (4953578) | 4953578..4953889 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| OWO50_RS23710 (4954118) | 4954118..4955026 | + | 909 | WP_001298596.1 | alpha/beta hydrolase | - |
| OWO50_RS23715 (4955090) | 4955090..4956031 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| OWO50_RS23720 (4956076) | 4956076..4956513 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| OWO50_RS23725 (4956510) | 4956510..4957382 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| OWO50_RS23730 (4957376) | 4957376..4957975 | - | 600 | WP_001298594.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12172.16 Da Isoelectric Point: 9.7791
>T265839 WP_000897305.1 NZ_CP113503:c4953889-4953578 [Escherichia coli]
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
ILFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|