Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | symER/SymE(toxin) |
| Location | 4274554..4274966 | Replicon | chromosome |
| Accession | NZ_CP113503 | ||
| Organism | Escherichia coli strain 16843 | ||
Toxin (Protein)
| Gene name | symE | Uniprot ID | S1NWQ7 |
| Locus tag | OWO50_RS20545 | Protein ID | WP_000132614.1 |
| Coordinates | 4274625..4274966 (+) | Length | 114 a.a. |
Antitoxin (RNA)
| Gene name | symR | ||
| Locus tag | - | ||
| Coordinates | 4274554..4274630 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OWO50_RS20535 (4271229) | 4271229..4272698 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
| OWO50_RS20540 (4272698) | 4272698..4274404 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_6 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_7 | - | Antitoxin |
| - (4274554) | 4274554..4274630 | - | 77 | NuclAT_7 | - | Antitoxin |
| OWO50_RS20545 (4274625) | 4274625..4274966 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
| OWO50_RS20550 (4275013) | 4275013..4276176 | - | 1164 | WP_072002093.1 | DUF1524 domain-containing protein | - |
| OWO50_RS20555 (4276224) | 4276224..4277106 | - | 883 | Protein_4034 | DUF262 domain-containing protein | - |
| OWO50_RS20560 (4277296) | 4277296..4277373 | + | 78 | Protein_4035 | hypothetical protein | - |
| OWO50_RS20565 (4277512) | 4277512..4278432 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| OWO50_RS20570 (4278617) | 4278617..4279897 | + | 1281 | WP_001298033.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | cheD | 4258434..4277169 | 18735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T265832 WP_000132614.1 NZ_CP113503:4274625-4274966 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT265832 NZ_CP113503:c4274630-4274554 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|