Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3878479..3879173 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | OWO50_RS18620 | Protein ID | WP_001263500.1 |
Coordinates | 3878479..3878877 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | OWO50_RS18625 | Protein ID | WP_000554758.1 |
Coordinates | 3878880..3879173 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS18595 (3873844) | 3873844..3874302 | - | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
OWO50_RS18600 (3874563) | 3874563..3876020 | + | 1458 | WP_001292999.1 | cytosol nonspecific dipeptidase | - |
OWO50_RS18605 (3876077) | 3876077..3876691 | - | 615 | WP_000602124.1 | peptide chain release factor H | - |
OWO50_RS18610 (3876688) | 3876688..3877827 | - | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
OWO50_RS18615 (3878017) | 3878017..3878469 | - | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
OWO50_RS18620 (3878479) | 3878479..3878877 | - | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
OWO50_RS18625 (3878880) | 3878880..3879173 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
OWO50_RS18630 (3879225) | 3879225..3880280 | - | 1056 | WP_001226168.1 | DNA polymerase IV | - |
OWO50_RS18635 (3880351) | 3880351..3881136 | - | 786 | WP_000207578.1 | putative lateral flagellar export/assembly protein LafU | - |
OWO50_RS18640 (3881108) | 3881108..3882820 | + | 1713 | Protein_3659 | flagellar biosynthesis protein FlhA | - |
OWO50_RS18645 (3882848) | 3882848..3883057 | + | 210 | WP_071778446.1 | hypothetical protein | - |
OWO50_RS18650 (3883140) | 3883140..3883637 | - | 498 | WP_000006241.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3878479..3898833 | 20354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T265829 WP_001263500.1 NZ_CP113503:c3878877-3878479 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|