Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3572140..3572819 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | OWO50_RS17190 | Protein ID | WP_000057523.1 |
Coordinates | 3572517..3572819 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | OWO50_RS17185 | Protein ID | WP_000806442.1 |
Coordinates | 3572140..3572481 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS17175 (3568384) | 3568384..3569316 | - | 933 | WP_000883025.1 | glutaminase A | - |
OWO50_RS17180 (3569578) | 3569578..3572082 | + | 2505 | WP_000083943.1 | copper-exporting P-type ATPase CopA | - |
OWO50_RS17185 (3572140) | 3572140..3572481 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
OWO50_RS17190 (3572517) | 3572517..3572819 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OWO50_RS17195 (3572952) | 3572952..3573746 | + | 795 | WP_000365148.1 | TraB/GumN family protein | - |
OWO50_RS17200 (3573950) | 3573950..3574429 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
OWO50_RS17205 (3574453) | 3574453..3575253 | + | 801 | WP_000439798.1 | hypothetical protein | - |
OWO50_RS17210 (3575250) | 3575250..3575753 | + | 504 | WP_000667000.1 | hypothetical protein | - |
OWO50_RS17215 (3575790) | 3575790..3577442 | - | 1653 | WP_000771760.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T265826 WP_000057523.1 NZ_CP113503:c3572819-3572517 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|