Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 653018..653817 | Replicon | chromosome |
Accession | NZ_CP113503 | ||
Organism | Escherichia coli strain 16843 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q8FDB4 |
Locus tag | OWO50_RS03210 | Protein ID | WP_000347252.1 |
Coordinates | 653018..653482 (-) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1PPV5 |
Locus tag | OWO50_RS03215 | Protein ID | WP_001296435.1 |
Coordinates | 653482..653817 (-) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OWO50_RS03180 (648019) | 648019..648453 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
OWO50_RS03185 (648471) | 648471..649349 | - | 879 | WP_001298314.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
OWO50_RS03190 (649339) | 649339..650118 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
OWO50_RS03195 (650129) | 650129..650602 | - | 474 | WP_001298322.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
OWO50_RS03200 (650625) | 650625..651905 | - | 1281 | WP_000681930.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
OWO50_RS03205 (652154) | 652154..652963 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
OWO50_RS03210 (653018) | 653018..653482 | - | 465 | WP_000347252.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
OWO50_RS03215 (653482) | 653482..653817 | - | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
OWO50_RS03220 (653966) | 653966..655537 | - | 1572 | WP_001273939.1 | galactarate dehydratase | - |
OWO50_RS03225 (655912) | 655912..657246 | + | 1335 | WP_000979025.1 | galactarate/glucarate/glycerate transporter GarP | - |
OWO50_RS03230 (657262) | 657262..658032 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17750.11 Da Isoelectric Point: 9.4947
>T265814 WP_000347252.1 NZ_CP113503:c653482-653018 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEESH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|