Detailed information of TA system TA265803

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 120648..121074
• Replicon: plasmid unnamed1
• Accession: NZ_CP113494
• Organism: Escherichia coli strain GTEN_97

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: E5R32_RS25925
• Protein ID: WP_001372321.1
• Coordinates: 120648..120773 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	120850..121074 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E5R32_RS25885 (115686)	115686..115913	-	228	WP_001254388.1	conjugal transfer relaxosome protein TraY	-
E5R32_RS25890 (116007)	116007..116693	-	687	WP_000332487.1	PAS domain-containing protein	-
E5R32_RS25895 (116887)	116887..117270	-	384	WP_001151564.1	conjugal transfer relaxosome DNA-binding protein TraM	-
E5R32_RS25900 (117556)	117556..118203	+	648	WP_124760006.1	transglycosylase SLT domain-containing protein	-
E5R32_RS25905 (118500)	118500..119321	-	822	WP_001234469.1	DUF932 domain-containing protein	-
E5R32_RS25910 (119442)	119442..119729	-	288	WP_000107537.1	hypothetical protein	-
E5R32_RS25915 (120027)	120027..120200	+	174	Protein_147	hypothetical protein	-
E5R32_RS25920 (120198)	120198..120428	-	231	WP_071587244.1	hypothetical protein	-
E5R32_RS25925 (120648)	120648..120773	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
E5R32_RS25930 (120715)	120715..120864	-	150	Protein_150	plasmid maintenance protein Mok	-
- (120850)	120850..121074	-	225	NuclAT_0	-	Antitoxin
- (120850)	120850..121074	-	225	NuclAT_0	-	Antitoxin
- (120850)	120850..121074	-	225	NuclAT_0	-	Antitoxin
- (120850)	120850..121074	-	225	NuclAT_0	-	Antitoxin
E5R32_RS25935 (120886)	120886..121074	+	189	WP_001299721.1	hypothetical protein	-
E5R32_RS25940 (121043)	121043..121805	-	763	Protein_152	plasmid SOS inhibition protein A	-
E5R32_RS25945 (121802)	121802..122236	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
E5R32_RS25950 (122291)	122291..124249	-	1959	WP_032152921.1	ParB/RepB/Spo0J family partition protein	-
E5R32_RS25955 (124308)	124308..124541	-	234	WP_000006018.1	DUF905 domain-containing protein	-
E5R32_RS25960 (124597)	124597..125124	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
E5R32_RS25965 (125594)	125594..125842	-	249	WP_071606928.1	hypothetical protein	-
E5R32_RS25970 (125764)	125764..125994	-	231	WP_001333093.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27	-	1..148685	148685

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T265803 WP_001372321.1 NZ_CP113494:c120773-120648 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT265803 NZ_CP113494:c121074-120850 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin