Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 120648..121074 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP113494 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | E5R32_RS25925 | Protein ID | WP_001372321.1 |
| Coordinates | 120648..120773 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 120850..121074 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS25885 (115686) | 115686..115913 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| E5R32_RS25890 (116007) | 116007..116693 | - | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| E5R32_RS25895 (116887) | 116887..117270 | - | 384 | WP_001151564.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| E5R32_RS25900 (117556) | 117556..118203 | + | 648 | WP_124760006.1 | transglycosylase SLT domain-containing protein | - |
| E5R32_RS25905 (118500) | 118500..119321 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| E5R32_RS25910 (119442) | 119442..119729 | - | 288 | WP_000107537.1 | hypothetical protein | - |
| E5R32_RS25915 (120027) | 120027..120200 | + | 174 | Protein_147 | hypothetical protein | - |
| E5R32_RS25920 (120198) | 120198..120428 | - | 231 | WP_071587244.1 | hypothetical protein | - |
| E5R32_RS25925 (120648) | 120648..120773 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| E5R32_RS25930 (120715) | 120715..120864 | - | 150 | Protein_150 | plasmid maintenance protein Mok | - |
| - (120850) | 120850..121074 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (120850) | 120850..121074 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (120850) | 120850..121074 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (120850) | 120850..121074 | - | 225 | NuclAT_0 | - | Antitoxin |
| E5R32_RS25935 (120886) | 120886..121074 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| E5R32_RS25940 (121043) | 121043..121805 | - | 763 | Protein_152 | plasmid SOS inhibition protein A | - |
| E5R32_RS25945 (121802) | 121802..122236 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| E5R32_RS25950 (122291) | 122291..124249 | - | 1959 | WP_032152921.1 | ParB/RepB/Spo0J family partition protein | - |
| E5R32_RS25955 (124308) | 124308..124541 | - | 234 | WP_000006018.1 | DUF905 domain-containing protein | - |
| E5R32_RS25960 (124597) | 124597..125124 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| E5R32_RS25965 (125594) | 125594..125842 | - | 249 | WP_071606928.1 | hypothetical protein | - |
| E5R32_RS25970 (125764) | 125764..125994 | - | 231 | WP_001333093.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..148685 | 148685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T265803 WP_001372321.1 NZ_CP113494:c120773-120648 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT265803 NZ_CP113494:c121074-120850 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|