Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5013701..5014303 | Replicon | chromosome |
| Accession | NZ_CP113493 | ||
| Organism | Escherichia coli strain GTEN_97 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A4Y9BEM6 |
| Locus tag | E5R32_RS24220 | Protein ID | WP_059332311.1 |
| Coordinates | 5013992..5014303 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | E5R32_RS24215 | Protein ID | WP_000356395.1 |
| Coordinates | 5013701..5013991 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5R32_RS24180 (5009325) | 5009325..5010227 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| E5R32_RS24185 (5010224) | 5010224..5010859 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| E5R32_RS24190 (5010856) | 5010856..5011785 | + | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| E5R32_RS24195 (5011967) | 5011967..5012209 | - | 243 | WP_001309881.1 | CopG family transcriptional regulator | - |
| E5R32_RS24200 (5012428) | 5012428..5012646 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| E5R32_RS24205 (5013065) | 5013065..5013343 | - | 279 | WP_001315112.1 | hypothetical protein | - |
| E5R32_RS24210 (5013395) | 5013395..5013616 | - | 222 | WP_001550354.1 | hypothetical protein | - |
| E5R32_RS24215 (5013701) | 5013701..5013991 | - | 291 | WP_000356395.1 | NadS family protein | Antitoxin |
| E5R32_RS24220 (5013992) | 5013992..5014303 | - | 312 | WP_059332311.1 | hypothetical protein | Toxin |
| E5R32_RS24225 (5014532) | 5014532..5015440 | + | 909 | WP_001550353.1 | alpha/beta hydrolase | - |
| E5R32_RS24230 (5015608) | 5015608..5016522 | - | 915 | WP_109553727.1 | transposase | - |
| E5R32_RS24235 (5016535) | 5016535..5017422 | - | 888 | Protein_4736 | hypothetical protein | - |
| E5R32_RS24240 (5017838) | 5017838..5018779 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| E5R32_RS24245 (5018824) | 5018824..5019261 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12212.25 Da Isoelectric Point: 10.0241
>T265801 WP_059332311.1 NZ_CP113493:c5014303-5013992 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPHYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPHYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|