Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4285134..4285861 | Replicon | chromosome |
Accession | NZ_CP113493 | ||
Organism | Escherichia coli strain GTEN_97 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | E5R32_RS20750 | Protein ID | WP_000547555.1 |
Coordinates | 4285550..4285861 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E5R32_RS20745 | Protein ID | WP_000126294.1 |
Coordinates | 4285134..4285553 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E5R32_RS20725 (4280219) | 4280219..4280746 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
E5R32_RS20730 (4280895) | 4280895..4281905 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
E5R32_RS20735 (4282165) | 4282165..4283622 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
E5R32_RS20740 (4283631) | 4283631..4285055 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
E5R32_RS20745 (4285134) | 4285134..4285553 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
E5R32_RS20750 (4285550) | 4285550..4285861 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
E5R32_RS20755 (4286028) | 4286028..4286498 | - | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
E5R32_RS20760 (4286491) | 4286491..4286901 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
E5R32_RS20765 (4286898) | 4286898..4287665 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
E5R32_RS20770 (4287665) | 4287665..4288207 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
E5R32_RS20775 (4288217) | 4288217..4289926 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T265795 WP_000547555.1 NZ_CP113493:c4285861-4285550 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT265795 WP_000126294.1 NZ_CP113493:c4285553-4285134 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|