Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2655703..2655925 Replicon chromosome
Accession NZ_CP113493
Organism Escherichia coli strain GTEN_97

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag E5R32_RS12935 Protein ID WP_000170955.1
Coordinates 2655703..2655810 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2655858..2655925 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5R32_RS12905 (2651384) 2651384..2652217 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
E5R32_RS12910 (2652214) 2652214..2652606 + 393 WP_000200377.1 invasion regulator SirB2 -
E5R32_RS12915 (2652610) 2652610..2653419 + 810 WP_001257044.1 invasion regulator SirB1 -
E5R32_RS12920 (2653455) 2653455..2654309 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
E5R32_RS12925 (2654504) 2654504..2654962 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
E5R32_RS12930 (2655168) 2655168..2655275 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2655323) 2655323..2655389 + 67 NuclAT_30 - -
- (2655323) 2655323..2655389 + 67 NuclAT_30 - -
- (2655323) 2655323..2655389 + 67 NuclAT_30 - -
- (2655323) 2655323..2655389 + 67 NuclAT_30 - -
- (2655323) 2655323..2655389 + 67 NuclAT_34 - -
- (2655323) 2655323..2655389 + 67 NuclAT_34 - -
- (2655323) 2655323..2655389 + 67 NuclAT_34 - -
- (2655323) 2655323..2655389 + 67 NuclAT_34 - -
- (2655323) 2655323..2655389 + 67 NuclAT_38 - -
- (2655323) 2655323..2655389 + 67 NuclAT_38 - -
- (2655323) 2655323..2655389 + 67 NuclAT_38 - -
- (2655323) 2655323..2655389 + 67 NuclAT_38 - -
- (2655323) 2655323..2655389 + 67 NuclAT_42 - -
- (2655323) 2655323..2655389 + 67 NuclAT_42 - -
- (2655323) 2655323..2655389 + 67 NuclAT_42 - -
- (2655323) 2655323..2655389 + 67 NuclAT_42 - -
- (2655323) 2655323..2655389 + 67 NuclAT_43 - -
- (2655323) 2655323..2655389 + 67 NuclAT_43 - -
- (2655323) 2655323..2655389 + 67 NuclAT_43 - -
- (2655323) 2655323..2655389 + 67 NuclAT_43 - -
- (2655325) 2655325..2655390 + 66 NuclAT_12 - -
- (2655325) 2655325..2655390 + 66 NuclAT_12 - -
- (2655325) 2655325..2655390 + 66 NuclAT_12 - -
- (2655325) 2655325..2655390 + 66 NuclAT_12 - -
- (2655325) 2655325..2655390 + 66 NuclAT_14 - -
- (2655325) 2655325..2655390 + 66 NuclAT_14 - -
- (2655325) 2655325..2655390 + 66 NuclAT_14 - -
- (2655325) 2655325..2655390 + 66 NuclAT_14 - -
- (2655325) 2655325..2655390 + 66 NuclAT_16 - -
- (2655325) 2655325..2655390 + 66 NuclAT_16 - -
- (2655325) 2655325..2655390 + 66 NuclAT_16 - -
- (2655325) 2655325..2655390 + 66 NuclAT_16 - -
- (2655325) 2655325..2655390 + 66 NuclAT_18 - -
- (2655325) 2655325..2655390 + 66 NuclAT_18 - -
- (2655325) 2655325..2655390 + 66 NuclAT_18 - -
- (2655325) 2655325..2655390 + 66 NuclAT_18 - -
- (2655325) 2655325..2655390 + 66 NuclAT_20 - -
- (2655325) 2655325..2655390 + 66 NuclAT_20 - -
- (2655325) 2655325..2655390 + 66 NuclAT_20 - -
- (2655325) 2655325..2655390 + 66 NuclAT_20 - -
- (2655325) 2655325..2655390 + 66 NuclAT_22 - -
- (2655325) 2655325..2655390 + 66 NuclAT_22 - -
- (2655325) 2655325..2655390 + 66 NuclAT_22 - -
- (2655325) 2655325..2655390 + 66 NuclAT_22 - -
E5R32_RS12935 (2655703) 2655703..2655810 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2655858) 2655858..2655925 + 68 NuclAT_11 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_11 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_11 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_11 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_13 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_13 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_13 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_13 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_15 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_15 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_15 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_15 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_17 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_17 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_17 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_17 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_19 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_19 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_19 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_19 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_21 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_21 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_21 - Antitoxin
- (2655858) 2655858..2655925 + 68 NuclAT_21 - Antitoxin
E5R32_RS12940 (2656215) 2656215..2657315 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
E5R32_RS12945 (2657585) 2657585..2657815 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E5R32_RS12950 (2657973) 2657973..2658668 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
E5R32_RS12955 (2658712) 2658712..2659065 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
E5R32_RS12960 (2659251) 2659251..2660645 + 1395 WP_001718153.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2654504..2654962 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T265788 WP_000170955.1 NZ_CP113493:c2655810-2655703 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT265788 NZ_CP113493:2655858-2655925 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References