Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 1550993..1551687 Replicon chromosome
Accession NZ_CP113493
Organism Escherichia coli strain GTEN_97

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag E5R32_RS07565 Protein ID WP_001263491.1
Coordinates 1551289..1551687 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag E5R32_RS07560 Protein ID WP_000554755.1
Coordinates 1550993..1551286 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5R32_RS07535 (1546614) 1546614..1546970 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
E5R32_RS07540 (1546963) 1546963..1547241 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
E5R32_RS07545 (1547346) 1547346..1549058 - 1713 Protein_1478 flagellar biosynthesis protein FlhA -
E5R32_RS07550 (1549030) 1549030..1549815 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
E5R32_RS07555 (1549886) 1549886..1550941 + 1056 WP_001550655.1 DNA polymerase IV -
E5R32_RS07560 (1550993) 1550993..1551286 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
E5R32_RS07565 (1551289) 1551289..1551687 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
E5R32_RS07570 (1551697) 1551697..1552149 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
E5R32_RS07575 (1552395) 1552395..1552601 + 207 Protein_1484 RtcB family protein -
E5R32_RS07580 (1552597) 1552597..1552949 + 353 Protein_1485 peptide chain release factor H -
E5R32_RS07585 (1553006) 1553006..1554463 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
E5R32_RS07590 (1554724) 1554724..1555182 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (1555778) 1555778..1555858 + 81 NuclAT_10 - -
- (1555778) 1555778..1555858 + 81 NuclAT_10 - -
- (1555778) 1555778..1555858 + 81 NuclAT_10 - -
- (1555778) 1555778..1555858 + 81 NuclAT_10 - -
E5R32_RS07595 (1555274) 1555274..1556518 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T265783 WP_001263491.1 NZ_CP113493:1551289-1551687 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT265783 WP_000554755.1 NZ_CP113493:1550993-1551286 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References