Detailed information of TA system TA265776

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 51874..52143
• Replicon: plasmid unnamed3
• Accession: NZ_CP113489
• Organism: Escherichia coli strain GTEN_23

Toxin (Protein)

• Gene name: hok
• Uniprot ID: G9G195
• Locus tag: FG550_RS26725
• Protein ID: WP_001323520.1
• Coordinates: 52027..52143 (+)
• Length: 39 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	51874..51939 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FG550_RS26690	47709..48194	+	486	WP_042029316.1	single-stranded DNA-binding protein	-
FG550_RS26695	48250..48483	+	234	WP_000006004.1	DUF905 domain-containing protein	-
FG550_RS26700	48542..50500	+	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
FG550_RS26705	50555..50989	+	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
FG550_RS26710	50986..51748	+	763	Protein_67	plasmid SOS inhibition protein A	-
FG550_RS26715	51717..51905	-	189	WP_001299721.1	hypothetical protein	-
-	51717..51941	+	225	NuclAT_0	-	-
-	51717..51941	+	225	NuclAT_0	-	-
-	51717..51941	+	225	NuclAT_0	-	-
-	51717..51941	+	225	NuclAT_0	-	-
-	51874..51939	-	66	-	-	Antitoxin
FG550_RS26720	51927..52076	+	150	Protein_69	plasmid maintenance protein Mok	-
FG550_RS26725	52027..52143	+	117	WP_001323520.1	type I toxin-antitoxin system Hok family toxin	Toxin
FG550_RS26730	52363..52593	+	231	WP_071587244.1	hypothetical protein	-
FG550_RS26735	52591..52764	-	174	Protein_72	hypothetical protein	-
FG550_RS26740	53062..53349	+	288	WP_000107537.1	hypothetical protein	-
FG550_RS26745	53470..54291	+	822	WP_001234469.1	DUF932 domain-containing protein	-
FG550_RS26750	54588..55190	-	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
FG550_RS26755	55513..55896	+	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
FG550_RS26760	56090..56761	+	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
FG550_RS26765	56898..57125	+	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (1-34)

Sequences

Toxin

Protein

• Length: 39 a.a.
• Molecular weight: 4455.23 Da
• Isoelectric Point: 8.5110

>T265776 WP_001323520.1 NZ_CP113489:52027-52143 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 117 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT265776 NZ_CP113489:c51939-51874 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Toxin

• AlphaFold DB: G9G195

Antitoxin