Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 51874..52143 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP113489 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | G9G195 |
| Locus tag | FG550_RS26725 | Protein ID | WP_001323520.1 |
| Coordinates | 52027..52143 (+) | Length | 39 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 51874..51939 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS26690 | 47709..48194 | + | 486 | WP_042029316.1 | single-stranded DNA-binding protein | - |
| FG550_RS26695 | 48250..48483 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| FG550_RS26700 | 48542..50500 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| FG550_RS26705 | 50555..50989 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| FG550_RS26710 | 50986..51748 | + | 763 | Protein_67 | plasmid SOS inhibition protein A | - |
| FG550_RS26715 | 51717..51905 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 51717..51941 | + | 225 | NuclAT_0 | - | - |
| - | 51717..51941 | + | 225 | NuclAT_0 | - | - |
| - | 51717..51941 | + | 225 | NuclAT_0 | - | - |
| - | 51717..51941 | + | 225 | NuclAT_0 | - | - |
| - | 51874..51939 | - | 66 | - | - | Antitoxin |
| FG550_RS26720 | 51927..52076 | + | 150 | Protein_69 | plasmid maintenance protein Mok | - |
| FG550_RS26725 | 52027..52143 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| FG550_RS26730 | 52363..52593 | + | 231 | WP_071587244.1 | hypothetical protein | - |
| FG550_RS26735 | 52591..52764 | - | 174 | Protein_72 | hypothetical protein | - |
| FG550_RS26740 | 53062..53349 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| FG550_RS26745 | 53470..54291 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| FG550_RS26750 | 54588..55190 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| FG550_RS26755 | 55513..55896 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| FG550_RS26760 | 56090..56761 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| FG550_RS26765 | 56898..57125 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T265776 WP_001323520.1 NZ_CP113489:52027-52143 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
Antitoxin
Download Length: 66 bp
>AT265776 NZ_CP113489:c51939-51874 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|