Detailed information of TA system TA265770

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 86861..87282
• Replicon: plasmid unnamed1
• Accession: NZ_CP113487
• Organism: Escherichia coli strain GTEN_23

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: FG550_RS25560
• Protein ID: WP_096937776.1
• Coordinates: 86861..86986 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	87084..87282 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
FG550_RS25520 (81936)	81936..82163	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
FG550_RS25525 (82258)	82258..82944	-	687	WP_001563714.1	PAS domain-containing protein	-
FG550_RS25530 (83134)	83134..83517	-	384	WP_001563713.1	conjugal transfer relaxosome DNA-binding protein TraM	-
FG550_RS25535 (83851)	83851..84441	+	591	WP_001375132.1	transglycosylase SLT domain-containing protein	-
FG550_RS25540 (84737)	84737..85558	-	822	WP_001234475.1	DUF932 domain-containing protein	-
FG550_RS25545 (85677)	85677..85963	-	287	Protein_109	hypothetical protein	-
FG550_RS25550 (85988)	85988..86194	-	207	WP_000547965.1	hypothetical protein	-
FG550_RS25555 (86264)	86264..86560	+	297	Protein_111	hypothetical protein	-
FG550_RS25560 (86861)	86861..86986	-	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
FG550_RS25565 (86928)	86928..87077	-	150	Protein_113	DUF5431 family protein	-
- (87084)	87084..87282	-	199	NuclAT_0	-	Antitoxin
- (87084)	87084..87282	-	199	NuclAT_0	-	Antitoxin
- (87084)	87084..87282	-	199	NuclAT_0	-	Antitoxin
- (87084)	87084..87282	-	199	NuclAT_0	-	Antitoxin
FG550_RS25570 (87251)	87251..88013	-	763	Protein_114	plasmid SOS inhibition protein A	-
FG550_RS25575 (88010)	88010..88444	-	435	WP_000845928.1	conjugation system SOS inhibitor PsiB	-
FG550_RS25580 (88499)	88499..89338	-	840	Protein_116	hypothetical protein	-
FG550_RS25585 (89533)	89533..91074	+	1542	WP_001298859.1	IS21-like element ISEc12 family transposase	-
FG550_RS25590 (91089)	91089..91835	+	747	WP_001016257.1	IS21-like element ISEc12 family helper ATPase IstB	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B	iutA / iucD / iucC / iucB / iucA	1..123389	123389

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T265770 WP_096937776.1 NZ_CP113487:c86986-86861 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT265770 NZ_CP113487:c87282-87084 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin