Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ralRA/- |
| Location | 5162346..5162717 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | ralR | Uniprot ID | F4VC37 |
| Locus tag | FG550_RS24870 | Protein ID | WP_001317028.1 |
| Coordinates | 5162523..5162717 (-) | Length | 65 a.a. |
Antitoxin (RNA)
| Gene name | ralA | ||
| Locus tag | - | ||
| Coordinates | 5162346..5162524 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS24845 (5158301) | 5158301..5159674 | + | 1374 | WP_001551034.1 | ATP-dependent RNA helicase DbpA | - |
| FG550_RS24850 (5159803) | 5159803..5160738 | - | 936 | WP_000662472.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
| FG550_RS24855 (5160790) | 5160790..5162025 | - | 1236 | WP_001551035.1 | site-specific integrase | - |
| FG550_RS24860 (5162027) | 5162027..5162242 | - | 216 | WP_000079604.1 | excisionase XisR | - |
| - (5162346) | 5162346..5162524 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (5162346) | 5162346..5162524 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (5162346) | 5162346..5162524 | + | 179 | NuclAT_0 | - | Antitoxin |
| - (5162346) | 5162346..5162524 | + | 179 | NuclAT_0 | - | Antitoxin |
| FG550_RS24865 (5162342) | 5162342..5162530 | - | 189 | WP_001551036.1 | DUF1187 family protein | - |
| FG550_RS24870 (5162523) | 5162523..5162717 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
| FG550_RS24875 (5162774) | 5162774..5163583 | - | 810 | WP_001551037.1 | recombination protein RecT | - |
| FG550_RS24880 (5163576) | 5163576..5166227 | - | 2652 | WP_001551038.1 | exodeoxyribonuclease VIII | - |
| FG550_RS24885 (5166329) | 5166329..5166604 | - | 276 | WP_001314664.1 | hypothetical protein | - |
| FG550_RS24890 (5166679) | 5166679..5166849 | - | 171 | WP_001551041.1 | YdaE family protein | - |
| FG550_RS24895 (5166849) | 5166849..5167070 | - | 222 | WP_000560221.1 | killing protein KilR | - |
| FG550_RS24900 (5167491) | 5167491..5167643 | - | 153 | WP_001551042.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 5152035..5179715 | 27680 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T265765 WP_001317028.1 NZ_CP113486:c5162717-5162523 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT265765 NZ_CP113486:5162346-5162524 [Escherichia coli]
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTCTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGGCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
