Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3916577..3917271 Replicon chromosome
Accession NZ_CP113486
Organism Escherichia coli strain GTEN_23

Toxin (Protein)


Gene name yafO Uniprot ID Q0T7Q5
Locus tag FG550_RS18815 Protein ID WP_001263491.1
Coordinates 3916873..3917271 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID L4JHF0
Locus tag FG550_RS18810 Protein ID WP_000554755.1
Coordinates 3916577..3916870 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FG550_RS18785 (3912198) 3912198..3912554 - 357 WP_001030484.1 type II toxin-antitoxin system HicB family antitoxin -
FG550_RS18790 (3912547) 3912547..3912825 - 279 WP_000598760.1 type II toxin-antitoxin system HicA family toxin -
FG550_RS18795 (3912930) 3912930..3914642 - 1713 Protein_3665 flagellar biosynthesis protein FlhA -
FG550_RS18800 (3914614) 3914614..3915399 + 786 WP_019842510.1 putative lateral flagellar export/assembly protein LafU -
FG550_RS18805 (3915470) 3915470..3916525 + 1056 WP_001550655.1 DNA polymerase IV -
FG550_RS18810 (3916577) 3916577..3916870 + 294 WP_000554755.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
FG550_RS18815 (3916873) 3916873..3917271 + 399 WP_001263491.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
FG550_RS18820 (3917281) 3917281..3917733 + 453 WP_019842500.1 GNAT family N-acetyltransferase -
FG550_RS18825 (3917979) 3917979..3918185 + 207 Protein_3671 RtcB family protein -
FG550_RS18830 (3918181) 3918181..3918533 + 353 Protein_3672 peptide chain release factor H -
FG550_RS18835 (3918590) 3918590..3920047 - 1458 WP_001293009.1 cytosol nonspecific dipeptidase -
FG550_RS18840 (3920308) 3920308..3920766 + 459 WP_001291990.1 xanthine phosphoribosyltransferase -
- (3921362) 3921362..3921442 + 81 NuclAT_11 - -
- (3921362) 3921362..3921442 + 81 NuclAT_11 - -
- (3921362) 3921362..3921442 + 81 NuclAT_11 - -
- (3921362) 3921362..3921442 + 81 NuclAT_11 - -
FG550_RS18845 (3920858) 3920858..3922102 + 1245 WP_000189541.1 esterase FrsA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15457.86 Da        Isoelectric Point: 8.0949

>T265760 WP_001263491.1 NZ_CP113486:3916873-3917271 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11235.78 Da        Isoelectric Point: 5.2170

>AT265760 WP_000554755.1 NZ_CP113486:3916577-3916870 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKLVKARFRPSAARLEEITRRA
EQYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TPK7

Antitoxin

Source ID Structure
AlphaFold DB A0A829G9H5

References