Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 2153304..2154103 | Replicon | chromosome |
Accession | NZ_CP113486 | ||
Organism | Escherichia coli strain GTEN_23 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | F0JQM9 |
Locus tag | FG550_RS10405 | Protein ID | WP_000347270.1 |
Coordinates | 2153639..2154103 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | A0A0V9H1L4 |
Locus tag | FG550_RS10400 | Protein ID | WP_001551693.1 |
Coordinates | 2153304..2153639 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FG550_RS10385 (2149089) | 2149089..2149859 | - | 771 | WP_001551692.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
FG550_RS10390 (2149875) | 2149875..2151209 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
FG550_RS10395 (2151584) | 2151584..2153155 | + | 1572 | WP_001273738.1 | galactarate dehydratase | - |
FG550_RS10400 (2153304) | 2153304..2153639 | + | 336 | WP_001551693.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
FG550_RS10405 (2153639) | 2153639..2154103 | + | 465 | WP_000347270.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
FG550_RS10410 (2154158) | 2154158..2154967 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
FG550_RS10415 (2155216) | 2155216..2156496 | + | 1281 | WP_001551694.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
FG550_RS10420 (2156519) | 2156519..2156992 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
FG550_RS10425 (2157003) | 2157003..2157790 | + | 788 | Protein_2046 | PTS N-acetylgalactosamine transporter subunit IIC | - |
FG550_RS10430 (2157780) | 2157780..2158658 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2144542..2154103 | 9561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17806.22 Da Isoelectric Point: 9.6924
>T265752 WP_000347270.1 NZ_CP113486:2153639-2154103 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEEAH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NQ90 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9H1L4 |