Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1541226..1541953 | Replicon | chromosome |
| Accession | NZ_CP113486 | ||
| Organism | Escherichia coli strain GTEN_23 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V0YLE2 |
| Locus tag | FG550_RS07405 | Protein ID | WP_000547555.1 |
| Coordinates | 1541642..1541953 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | FG550_RS07400 | Protein ID | WP_000126294.1 |
| Coordinates | 1541226..1541645 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FG550_RS07380 (1536311) | 1536311..1536838 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| FG550_RS07385 (1536987) | 1536987..1537997 | - | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
| FG550_RS07390 (1538257) | 1538257..1539714 | + | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| FG550_RS07395 (1539723) | 1539723..1541147 | + | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
| FG550_RS07400 (1541226) | 1541226..1541645 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| FG550_RS07405 (1541642) | 1541642..1541953 | - | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| FG550_RS07410 (1542120) | 1542120..1542590 | - | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
| FG550_RS07415 (1542583) | 1542583..1542993 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| FG550_RS07420 (1542990) | 1542990..1543757 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| FG550_RS07425 (1543757) | 1543757..1544299 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| FG550_RS07430 (1544309) | 1544309..1546018 | - | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T265747 WP_000547555.1 NZ_CP113486:c1541953-1541642 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT265747 WP_000126294.1 NZ_CP113486:c1541645-1541226 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|