Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 67424..68075 Replicon plasmid pC9_1
Accession NZ_CP113443
Organism Acinetobacter baumannii strain C9

Toxin (Protein)


Gene name higB Uniprot ID S3SZA7
Locus tag OQH41_RS18640 Protein ID WP_000269903.1
Coordinates 67424..67780 (+) Length 119 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag OQH41_RS18645 Protein ID WP_001140619.1
Coordinates 67773..68075 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OQH41_RS18610 (OQH41_18610) 62618..62881 - 264 WP_265615443.1 hypothetical protein -
OQH41_RS18615 (OQH41_18615) 62885..63097 - 213 WP_024436592.1 hypothetical protein -
OQH41_RS18620 (OQH41_18620) 63312..63638 - 327 WP_265615442.1 hypothetical protein -
OQH41_RS18625 (OQH41_18625) 63646..64869 - 1224 WP_265615441.1 phage/plasmid replication protein, II/X family -
OQH41_RS18630 (OQH41_18630) 64985..65188 + 204 WP_001140379.1 hypothetical protein -
OQH41_RS18635 (OQH41_18635) 65548..66873 + 1326 Protein_69 ISNCY family transposase -
OQH41_RS18640 (OQH41_18640) 67424..67780 + 357 WP_000269903.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OQH41_RS18645 (OQH41_18645) 67773..68075 + 303 WP_001140619.1 XRE family transcriptional regulator Antitoxin
OQH41_RS18650 (OQH41_18650) 68068..68277 + 210 WP_000069471.1 hypothetical protein -
OQH41_RS18655 (OQH41_18655) 68387..68614 - 228 WP_025469214.1 hypothetical protein -
OQH41_RS18660 (OQH41_18660) 69152..70084 - 933 WP_269006111.1 IS5-like element ISAba13 family transposase -
OQH41_RS18665 (OQH41_18665) 70138..70287 - 150 Protein_75 type II toxin-antitoxin system RelE/ParE family toxin -
OQH41_RS18670 (OQH41_18670) 70531..70851 - 321 WP_004704395.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OQH41_RS18675 (OQH41_18675) 71039..71167 + 129 WP_002123981.1 AAA family ATPase -
OQH41_RS18680 (OQH41_18680) 71221..71427 + 207 WP_235824376.1 AAA family ATPase -
OQH41_RS18685 (OQH41_18685) 71355..71900 + 546 Protein_79 IS5-like element ISAba13 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..115742 115742
- inside IScluster/Tn - - 65872..76682 10810


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

HigA2-like, helix-turn-helix domain

(13-89)


Sequences

Toxin        


Download         Length: 119 a.a.        Molecular weight: 13486.45 Da        Isoelectric Point: 7.1645

>T265731 WP_000269903.1 NZ_CP113443:67424-67780 [Acinetobacter baumannii]
MWTVITTDLFNEWLAQQDQSTQEKVLAALVVLQQQGPSLGRPLVDTVYDSKFTNMKELRVQHRGKPLRAFFAFDPLRQAI
VLCIGDKGGKKRFYKEMLDIADQQYEIHLSTLGDQSNG

Download         Length: 357 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11206.01 Da        Isoelectric Point: 6.7282

>AT265731 WP_001140619.1 NZ_CP113443:67773-68075 [Acinetobacter baumannii]
MAKTLQELLANRSPESQARIQQMADELLLETQLHLIREELEISQKELAATLGIKQPSLSAIENRGHDLKISTMKKYVEAM
GGKLRIDVELPTGKHIGFNV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A836MG83

Antitoxin

Source ID Structure

References