Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 2635647..2636890 | Replicon | chromosome |
Accession | NZ_CP113438 | ||
Organism | Legionella pneumophila strain PATHC003 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | Q5ZSZ6 |
Locus tag | OXA91_RS11705 | Protein ID | WP_010948074.1 |
Coordinates | 2635952..2636890 (+) | Length | 313 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | Q5ZSZ7 |
Locus tag | OXA91_RS11700 | Protein ID | WP_010948073.1 |
Coordinates | 2635647..2635955 (+) | Length | 103 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA91_RS11670 (OXA91_11670) | 2631083..2631448 | + | 366 | WP_010948069.1 | BRCT domain-containing protein | - |
OXA91_RS11675 (OXA91_11675) | 2631805..2632170 | - | 366 | WP_010948070.1 | TraK family protein | - |
OXA91_RS11680 (OXA91_11680) | 2632355..2632495 | - | 141 | WP_153802426.1 | hypothetical protein | - |
OXA91_RS11685 (OXA91_11685) | 2632498..2634249 | - | 1752 | WP_010948071.1 | DUF927 domain-containing protein | - |
OXA91_RS11690 (OXA91_11690) | 2634315..2634590 | - | 276 | WP_010948072.1 | helix-turn-helix domain-containing protein | - |
OXA91_RS11695 (OXA91_11695) | 2635423..2635650 | + | 228 | WP_006870829.1 | helix-turn-helix transcriptional regulator | - |
OXA91_RS11700 (OXA91_11700) | 2635647..2635955 | + | 309 | WP_010948073.1 | HipA N-terminal domain-containing protein | Antitoxin |
OXA91_RS11705 (OXA91_11705) | 2635952..2636890 | + | 939 | WP_010948074.1 | lpg2370 family Dot/Icm T4SS effector | Toxin |
OXA91_RS11710 (OXA91_11710) | 2637433..2638047 | + | 615 | WP_010948075.1 | hypothetical protein | - |
OXA91_RS11715 (OXA91_11715) | 2638203..2638409 | - | 207 | WP_015444115.1 | hypothetical protein | - |
OXA91_RS11720 (OXA91_11720) | 2638746..2640014 | + | 1269 | WP_010948076.1 | lpg2372 family Dot/Icm T4SS effector | - |
OXA91_RS11725 (OXA91_11725) | 2640484..2640774 | - | 291 | WP_223804318.1 | hypothetical protein | - |
OXA91_RS11730 (OXA91_11730) | 2640755..2641420 | - | 666 | WP_015444114.1 | hypothetical protein | - |
OXA91_RS11735 (OXA91_11735) | 2641596..2641727 | - | 132 | WP_015444112.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2629669..2630844 | 1175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 313 a.a. Molecular weight: 36077.81 Da Isoelectric Point: 8.6882
>T265721 WP_010948074.1 NZ_CP113438:2635952-2636890 [Legionella pneumophila]
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
MKHCPITYEKISDQENYSQRGLHLLSPQLKNLSPLDLSADEQRQEAIARVGKMSVQGVQKKLSAKLKIKEGCFEIVDQYG
QYILKPQSDIYPELPENEAITMTLAKTIGLEVPVHGLVYSKDNSLTYFIKRFDRIGHNKKLALEDFAQLSGEDRHTKYKS
SMEKVIAVIEQFCTFPKIEFVKLFKLTLFNFLVGNEDMHLKNFSLITKDRKISISPAYDLLNSTIAQKNTKEELALPLKG
KKNNLTKSDFLKYFAIEKLGLNQNVIDGIVQEFHQVIPKWQELIGFSFLSQEMQEKYLELLEQRCKRLNFFD
Download Length: 939 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|