Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_31 |
Location | 74432..75036 | Replicon | chromosome |
Accession | NZ_CP113437 | ||
Organism | Legionella pneumophila strain PATHC007 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A128WF47 |
Locus tag | OXA90_RS00370 | Protein ID | WP_011212715.1 |
Coordinates | 74432..74755 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OXA90_RS00375 | Protein ID | WP_011212716.1 |
Coordinates | 74752..75036 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA90_RS00345 (OXA90_00345) | 69792..70637 | - | 846 | WP_011212710.1 | hypothetical protein | - |
OXA90_RS00350 (OXA90_00350) | 70966..71220 | - | 255 | WP_041173947.1 | hypothetical protein | - |
OXA90_RS00355 (OXA90_00355) | 71758..72699 | + | 942 | WP_011212712.1 | hypothetical protein | - |
OXA90_RS00360 (OXA90_00360) | 72714..72902 | + | 189 | WP_224750877.1 | transposase | - |
OXA90_RS00365 (OXA90_00365) | 73128..74348 | + | 1221 | WP_011212714.1 | site-specific integrase | - |
OXA90_RS00370 (OXA90_00370) | 74432..74755 | + | 324 | WP_011212715.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OXA90_RS00375 (OXA90_00375) | 74752..75036 | + | 285 | WP_011212716.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OXA90_RS00380 (OXA90_00380) | 75230..76051 | + | 822 | WP_224750878.1 | hypothetical protein | - |
OXA90_RS00385 (OXA90_00385) | 76357..76755 | + | 399 | WP_011212718.1 | DUF1780 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12144.36 Da Isoelectric Point: 9.7878
>T265719 WP_011212715.1 NZ_CP113437:74432-74755 [Legionella pneumophila]
MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPHTEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVL
HAFVKKSAKTPKPDLQLALKRKREVEK
MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPHTEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVL
HAFVKKSAKTPKPDLQLALKRKREVEK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|