Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 3234232..3234869 | Replicon | chromosome |
Accession | NZ_CP113436 | ||
Organism | Legionella pneumophila strain PATHC021 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | OXA88_RS14375 | Protein ID | WP_268169339.1 |
Coordinates | 3234525..3234869 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | OXA88_RS14370 | Protein ID | WP_010948599.1 |
Coordinates | 3234232..3234522 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXA88_RS14350 (OXA88_14350) | 3230293..3231780 | + | 1488 | WP_010948597.1 | lpg2912 family Dot/Icm T4SS effector | - |
OXA88_RS14355 (OXA88_14355) | 3231942..3233384 | - | 1443 | WP_010948598.1 | ATP-binding protein | - |
OXA88_RS14360 (OXA88_14360) | 3233566..3233715 | - | 150 | WP_154074588.1 | hypothetical protein | - |
OXA88_RS14365 (OXA88_14365) | 3233752..3233943 | + | 192 | WP_014327021.1 | hypothetical protein | - |
OXA88_RS14370 (OXA88_14370) | 3234232..3234522 | - | 291 | WP_010948599.1 | helix-turn-helix domain-containing protein | Antitoxin |
OXA88_RS14375 (OXA88_14375) | 3234525..3234869 | - | 345 | WP_268169339.1 | hypothetical protein | Toxin |
OXA88_RS14380 (OXA88_14380) | 3235074..3235577 | - | 504 | WP_015443887.1 | hypothetical protein | - |
OXA88_RS14385 (OXA88_14385) | 3235687..3236733 | - | 1047 | WP_010948602.1 | FAD-dependent oxidoreductase | - |
OXA88_RS14390 (OXA88_14390) | 3237037..3237999 | - | 963 | WP_015443886.1 | lytic murein transglycosylase | - |
OXA88_RS14395 (OXA88_14395) | 3238529..3239707 | + | 1179 | WP_010948604.1 | serine hydrolase domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13249.12 Da Isoelectric Point: 5.2063
>T265717 WP_268169339.1 NZ_CP113436:c3234869-3234525 [Legionella pneumophila]
MIFIETPIFTEDVKELLSDEEYAEFQEYLADNPLAGDVIQQTGKLANWQTGKLANCEKFDGHFKANGKRGGVRIIYYYVT
PASQIRLLLIYKKGIQDDLTTDQKKMLRQLNERW
MIFIETPIFTEDVKELLSDEEYAEFQEYLADNPLAGDVIQQTGKLANWQTGKLANCEKFDGHFKANGKRGGVRIIYYYVT
PASQIRLLLIYKKGIQDDLTTDQKKMLRQLNERW
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|